A modular tool to aggregate results from bioinformatics analyses across many samples into a single report.
This report has been generated by the bigbio/quantms analysis pipeline. For information about how to interpret these results, please see the documentation.
/home/runner/work/pmultiqc/pmultiqc/data_temp
pmultiqc
pmultiqc is a MultiQC module to show the pipeline performance of mass spectrometry based quantification pipelines such as nf-core/quantms, MaxQuant, DIA-NN, FragPipe, and nf-core/mhcquant.https://github.com/bigbio/pmultiqc
Experimental Design and Metadata
Experimental Design
| Sample Name | Condition: SP | Condition: CT | Condition: QY | Condition: CV | BioReplicate | Fraction Group | Fraction | Label |
|---|---|---|---|---|---|---|---|---|
| Sample 1 | Saccharomyces cerevisiae | Mixture | 10% | in-house | 1 | |||
| 1 | 1 | 1 | ||||||
| 1 | 2 | 1 | ||||||
| 1 | 3 | 1 | ||||||
| 1 | 4 | 1 | ||||||
| 1 | 5 | 1 | ||||||
| 1 | 6 | 1 | ||||||
| 1 | 7 | 1 | ||||||
| 1 | 8 | 1 | ||||||
| 1 | 9 | 1 | ||||||
| 1 | 10 | 1 | ||||||
| 1 | 11 | 1 | ||||||
| Sample 2 | Saccharomyces cerevisiae | Mixture | 10% | in-house | 2 | |||
| 1 | 1 | 2 | ||||||
| 1 | 2 | 2 | ||||||
| 1 | 3 | 2 | ||||||
| 1 | 4 | 2 | ||||||
| 1 | 5 | 2 | ||||||
| 1 | 6 | 2 | ||||||
| 1 | 7 | 2 | ||||||
| 1 | 8 | 2 | ||||||
| 1 | 9 | 2 | ||||||
| 1 | 10 | 2 | ||||||
| 1 | 11 | 2 | ||||||
| Sample 3 | Saccharomyces cerevisiae | Mixture | 10% | in-house | 3 | |||
| 1 | 1 | 3 | ||||||
| 1 | 2 | 3 | ||||||
| 1 | 3 | 3 | ||||||
| 1 | 4 | 3 | ||||||
| 1 | 5 | 3 | ||||||
| 1 | 6 | 3 | ||||||
| 1 | 7 | 3 | ||||||
| 1 | 8 | 3 | ||||||
| 1 | 9 | 3 | ||||||
| 1 | 10 | 3 | ||||||
| 1 | 11 | 3 | ||||||
| Sample 4 | Saccharomyces cerevisiae | Mixture | 5% | in-house | 4 | |||
| 1 | 1 | 4 | ||||||
| 1 | 2 | 4 | ||||||
| 1 | 3 | 4 | ||||||
| 1 | 4 | 4 | ||||||
| 1 | 5 | 4 | ||||||
| 1 | 6 | 4 | ||||||
| 1 | 7 | 4 | ||||||
| 1 | 8 | 4 | ||||||
| 1 | 9 | 4 | ||||||
| 1 | 10 | 4 | ||||||
| 1 | 11 | 4 | ||||||
| Sample 5 | Saccharomyces cerevisiae | Mixture | 5% | in-house | 5 | |||
| 1 | 1 | 5 | ||||||
| 1 | 2 | 5 | ||||||
| 1 | 3 | 5 | ||||||
| 1 | 4 | 5 | ||||||
| 1 | 5 | 5 | ||||||
| 1 | 6 | 5 | ||||||
| 1 | 7 | 5 | ||||||
| 1 | 8 | 5 | ||||||
| 1 | 9 | 5 | ||||||
| 1 | 10 | 5 | ||||||
| 1 | 11 | 5 | ||||||
| Sample 6 | Saccharomyces cerevisiae | Mixture | 5% | in-house | 6 | |||
| 1 | 1 | 6 | ||||||
| 1 | 2 | 6 | ||||||
| 1 | 3 | 6 | ||||||
| 1 | 4 | 6 | ||||||
| 1 | 5 | 6 | ||||||
| 1 | 6 | 6 | ||||||
| 1 | 7 | 6 | ||||||
| 1 | 8 | 6 | ||||||
| 1 | 9 | 6 | ||||||
| 1 | 10 | 6 | ||||||
| 1 | 11 | 6 | ||||||
| Sample 7 | Saccharomyces cerevisiae | Mixture | 5% | in-house | 7 | |||
| 1 | 1 | 7 | ||||||
| 1 | 2 | 7 | ||||||
| 1 | 3 | 7 | ||||||
| 1 | 4 | 7 | ||||||
| 1 | 5 | 7 | ||||||
| 1 | 6 | 7 | ||||||
| 1 | 7 | 7 | ||||||
| 1 | 8 | 7 | ||||||
| 1 | 9 | 7 | ||||||
| 1 | 10 | 7 | ||||||
| 1 | 11 | 7 | ||||||
| Sample 8 | Saccharomyces cerevisiae | Mixture | 3.3% | in-house | 8 | |||
| 1 | 1 | 8 | ||||||
| 1 | 2 | 8 | ||||||
| 1 | 3 | 8 | ||||||
| 1 | 4 | 8 | ||||||
| 1 | 5 | 8 | ||||||
| 1 | 6 | 8 | ||||||
| 1 | 7 | 8 | ||||||
| 1 | 8 | 8 | ||||||
| 1 | 9 | 8 | ||||||
| 1 | 10 | 8 | ||||||
| 1 | 11 | 8 | ||||||
| Sample 9 | Saccharomyces cerevisiae | Mixture | 3.3% | in-house | 9 | |||
| 1 | 1 | 9 | ||||||
| 1 | 2 | 9 | ||||||
| 1 | 3 | 9 | ||||||
| 1 | 4 | 9 | ||||||
| 1 | 5 | 9 | ||||||
| 1 | 6 | 9 | ||||||
| 1 | 7 | 9 | ||||||
| 1 | 8 | 9 | ||||||
| 1 | 9 | 9 | ||||||
| 1 | 10 | 9 | ||||||
| 1 | 11 | 9 | ||||||
| Sample 10 | Saccharomyces cerevisiae | Mixture | 3.3% | in-house | 10 | |||
| 1 | 1 | 10 | ||||||
| 1 | 2 | 10 | ||||||
| 1 | 3 | 10 | ||||||
| 1 | 4 | 10 | ||||||
| 1 | 5 | 10 | ||||||
| 1 | 6 | 10 | ||||||
| 1 | 7 | 10 | ||||||
| 1 | 8 | 10 | ||||||
| 1 | 9 | 10 | ||||||
| 1 | 10 | 10 | ||||||
| 1 | 11 | 10 | ||||||
| Sample 11 | Saccharomyces cerevisiae | Mixture | 3.3% | in-house | 11 | |||
| 1 | 1 | 11 | ||||||
| 1 | 2 | 11 | ||||||
| 1 | 3 | 11 | ||||||
| 1 | 4 | 11 | ||||||
| 1 | 5 | 11 | ||||||
| 1 | 6 | 11 | ||||||
| 1 | 7 | 11 | ||||||
| 1 | 8 | 11 | ||||||
| 1 | 9 | 11 | ||||||
| 1 | 10 | 11 | ||||||
| 1 | 11 | 11 |
Results Overview
Summary Table
| #MS2 Spectra | #Identified MS2 Spectra | %Identified MS2 Spectra | #Peptides Identified | #Proteins Identified | #Proteins Quantified |
|---|---|---|---|---|---|
| 433836 | 154772 | 35.68% | 90555 | 9655 | 9655 |
HeatMap
Pipeline Result Statistics
| Sample Name | Condition: SP | Condition: CT | Condition: QY | Condition: CV | Fraction | #Peptide IDs | #Unambiguous Peptide IDs | #Modified Peptide IDs | #Protein (group) IDs |
|---|---|---|---|---|---|---|---|---|---|
| Sample 1 | Saccharomyces cerevisiae | Mixture | 10% | in-house | 98697 | 91611 | 98697 | 12872 | |
| 1 | 12495 | 11321 | 12495 | 5631 | |||||
| 2 | 13568 | 12325 | 13568 | 6045 | |||||
| 3 | 13003 | 11783 | 13003 | 5875 | |||||
| 4 | 13433 | 12260 | 13433 | 5902 | |||||
| 5 | 14216 | 12956 | 14216 | 6159 | |||||
| 6 | 18009 | 16369 | 18009 | 6420 | |||||
| 7 | 16285 | 14718 | 16285 | 6068 | |||||
| 8 | 14215 | 13004 | 14215 | 6077 | |||||
| 9 | 14554 | 13271 | 14554 | 6093 | |||||
| 10 | 13765 | 12537 | 13765 | 6024 | |||||
| 11 | 12 | 12 | 12 | 10 | |||||
| Sample 2 | Saccharomyces cerevisiae | Mixture | 10% | in-house | 98697 | 91611 | 98697 | 12872 | |
| 1 | 12495 | 11321 | 12495 | 5631 | |||||
| 2 | 13568 | 12325 | 13568 | 6045 | |||||
| 3 | 13003 | 11783 | 13003 | 5875 | |||||
| 4 | 13433 | 12260 | 13433 | 5902 | |||||
| 5 | 14216 | 12956 | 14216 | 6159 | |||||
| 6 | 18009 | 16369 | 18009 | 6420 | |||||
| 7 | 16285 | 14718 | 16285 | 6068 | |||||
| 8 | 14215 | 13004 | 14215 | 6077 | |||||
| 9 | 14554 | 13271 | 14554 | 6093 | |||||
| 10 | 13765 | 12537 | 13765 | 6024 | |||||
| 11 | 12 | 12 | 12 | 10 | |||||
| Sample 3 | Saccharomyces cerevisiae | Mixture | 10% | in-house | 98697 | 91611 | 98697 | 12872 | |
| 1 | 12495 | 11321 | 12495 | 5631 | |||||
| 2 | 13568 | 12325 | 13568 | 6045 | |||||
| 3 | 13003 | 11783 | 13003 | 5875 | |||||
| 4 | 13433 | 12260 | 13433 | 5902 | |||||
| 5 | 14216 | 12956 | 14216 | 6159 | |||||
| 6 | 18009 | 16369 | 18009 | 6420 | |||||
| 7 | 16285 | 14718 | 16285 | 6068 | |||||
| 8 | 14215 | 13004 | 14215 | 6077 | |||||
| 9 | 14554 | 13271 | 14554 | 6093 | |||||
| 10 | 13765 | 12537 | 13765 | 6024 | |||||
| 11 | 12 | 12 | 12 | 10 | |||||
| Sample 4 | Saccharomyces cerevisiae | Mixture | 5% | in-house | 98697 | 91611 | 98697 | 12872 | |
| 1 | 12495 | 11321 | 12495 | 5631 | |||||
| 2 | 13568 | 12325 | 13568 | 6045 | |||||
| 3 | 13003 | 11783 | 13003 | 5875 | |||||
| 4 | 13433 | 12260 | 13433 | 5902 | |||||
| 5 | 14216 | 12956 | 14216 | 6159 | |||||
| 6 | 18009 | 16369 | 18009 | 6420 | |||||
| 7 | 16285 | 14718 | 16285 | 6068 | |||||
| 8 | 14215 | 13004 | 14215 | 6077 | |||||
| 9 | 14554 | 13271 | 14554 | 6093 | |||||
| 10 | 13765 | 12537 | 13765 | 6024 | |||||
| 11 | 12 | 12 | 12 | 10 | |||||
| Sample 5 | Saccharomyces cerevisiae | Mixture | 5% | in-house | 98697 | 91611 | 98697 | 12872 | |
| 1 | 12495 | 11321 | 12495 | 5631 | |||||
| 2 | 13568 | 12325 | 13568 | 6045 | |||||
| 3 | 13003 | 11783 | 13003 | 5875 | |||||
| 4 | 13433 | 12260 | 13433 | 5902 | |||||
| 5 | 14216 | 12956 | 14216 | 6159 | |||||
| 6 | 18009 | 16369 | 18009 | 6420 | |||||
| 7 | 16285 | 14718 | 16285 | 6068 | |||||
| 8 | 14215 | 13004 | 14215 | 6077 | |||||
| 9 | 14554 | 13271 | 14554 | 6093 | |||||
| 10 | 13765 | 12537 | 13765 | 6024 | |||||
| 11 | 12 | 12 | 12 | 10 | |||||
| Sample 6 | Saccharomyces cerevisiae | Mixture | 5% | in-house | 98697 | 91611 | 98697 | 12872 | |
| 1 | 12495 | 11321 | 12495 | 5631 | |||||
| 2 | 13568 | 12325 | 13568 | 6045 | |||||
| 3 | 13003 | 11783 | 13003 | 5875 | |||||
| 4 | 13433 | 12260 | 13433 | 5902 | |||||
| 5 | 14216 | 12956 | 14216 | 6159 | |||||
| 6 | 18009 | 16369 | 18009 | 6420 | |||||
| 7 | 16285 | 14718 | 16285 | 6068 | |||||
| 8 | 14215 | 13004 | 14215 | 6077 | |||||
| 9 | 14554 | 13271 | 14554 | 6093 | |||||
| 10 | 13765 | 12537 | 13765 | 6024 | |||||
| 11 | 12 | 12 | 12 | 10 | |||||
| Sample 7 | Saccharomyces cerevisiae | Mixture | 5% | in-house | 98697 | 91611 | 98697 | 12872 | |
| 1 | 12495 | 11321 | 12495 | 5631 | |||||
| 2 | 13568 | 12325 | 13568 | 6045 | |||||
| 3 | 13003 | 11783 | 13003 | 5875 | |||||
| 4 | 13433 | 12260 | 13433 | 5902 | |||||
| 5 | 14216 | 12956 | 14216 | 6159 | |||||
| 6 | 18009 | 16369 | 18009 | 6420 | |||||
| 7 | 16285 | 14718 | 16285 | 6068 | |||||
| 8 | 14215 | 13004 | 14215 | 6077 | |||||
| 9 | 14554 | 13271 | 14554 | 6093 | |||||
| 10 | 13765 | 12537 | 13765 | 6024 | |||||
| 11 | 12 | 12 | 12 | 10 | |||||
| Sample 8 | Saccharomyces cerevisiae | Mixture | 3.3% | in-house | 98697 | 91611 | 98697 | 12872 | |
| 1 | 12495 | 11321 | 12495 | 5631 | |||||
| 2 | 13568 | 12325 | 13568 | 6045 | |||||
| 3 | 13003 | 11783 | 13003 | 5875 | |||||
| 4 | 13433 | 12260 | 13433 | 5902 | |||||
| 5 | 14216 | 12956 | 14216 | 6159 | |||||
| 6 | 18009 | 16369 | 18009 | 6420 | |||||
| 7 | 16285 | 14718 | 16285 | 6068 | |||||
| 8 | 14215 | 13004 | 14215 | 6077 | |||||
| 9 | 14554 | 13271 | 14554 | 6093 | |||||
| 10 | 13765 | 12537 | 13765 | 6024 | |||||
| 11 | 12 | 12 | 12 | 10 | |||||
| Sample 9 | Saccharomyces cerevisiae | Mixture | 3.3% | in-house | 98697 | 91611 | 98697 | 12872 | |
| 1 | 12495 | 11321 | 12495 | 5631 | |||||
| 2 | 13568 | 12325 | 13568 | 6045 | |||||
| 3 | 13003 | 11783 | 13003 | 5875 | |||||
| 4 | 13433 | 12260 | 13433 | 5902 | |||||
| 5 | 14216 | 12956 | 14216 | 6159 | |||||
| 6 | 18009 | 16369 | 18009 | 6420 | |||||
| 7 | 16285 | 14718 | 16285 | 6068 | |||||
| 8 | 14215 | 13004 | 14215 | 6077 | |||||
| 9 | 14554 | 13271 | 14554 | 6093 | |||||
| 10 | 13765 | 12537 | 13765 | 6024 | |||||
| 11 | 12 | 12 | 12 | 10 | |||||
| Sample 10 | Saccharomyces cerevisiae | Mixture | 3.3% | in-house | 98697 | 91611 | 98697 | 12872 | |
| 1 | 12495 | 11321 | 12495 | 5631 | |||||
| 2 | 13568 | 12325 | 13568 | 6045 | |||||
| 3 | 13003 | 11783 | 13003 | 5875 | |||||
| 4 | 13433 | 12260 | 13433 | 5902 | |||||
| 5 | 14216 | 12956 | 14216 | 6159 | |||||
| 6 | 18009 | 16369 | 18009 | 6420 | |||||
| 7 | 16285 | 14718 | 16285 | 6068 | |||||
| 8 | 14215 | 13004 | 14215 | 6077 | |||||
| 9 | 14554 | 13271 | 14554 | 6093 | |||||
| 10 | 13765 | 12537 | 13765 | 6024 | |||||
| 11 | 12 | 12 | 12 | 10 | |||||
| Sample 11 | Saccharomyces cerevisiae | Mixture | 3.3% | in-house | 98697 | 91611 | 98697 | 12872 | |
| 1 | 12495 | 11321 | 12495 | 5631 | |||||
| 2 | 13568 | 12325 | 13568 | 6045 | |||||
| 3 | 13003 | 11783 | 13003 | 5875 | |||||
| 4 | 13433 | 12260 | 13433 | 5902 | |||||
| 5 | 14216 | 12956 | 14216 | 6159 | |||||
| 6 | 18009 | 16369 | 18009 | 6420 | |||||
| 7 | 16285 | 14718 | 16285 | 6068 | |||||
| 8 | 14215 | 13004 | 14215 | 6077 | |||||
| 9 | 14554 | 13271 | 14554 | 6093 | |||||
| 10 | 13765 | 12537 | 13765 | 6024 | |||||
| 11 | 12 | 12 | 12 | 10 |
File Names vs. Acquisition Times
| File Name | Acquisition Datetime |
|---|---|
| a05058 | 2017-04-05 00:38:45 |
| a05059 | 2017-04-05 04:14:11 |
| a05060 | 2017-04-05 07:49:24 |
| a05061 | 2017-04-05 11:24:37 |
| a05062 | 2017-04-05 15:00:06 |
| a05063 | 2017-04-05 18:32:46 |
| a05064 | 2017-04-05 22:05:41 |
| a05065 | 2017-04-06 10:43:06 |
| a05066 | 2017-04-06 14:15:46 |
| a05067 | 2017-04-06 17:48:21 |
| a05068 | 2017-04-06 21:21:20 |
Identification Summary
Number of Peptides identified Per Protein
ProteinGroups Count
Peptide ID Count
Missed Cleavages
FragPipe: [Number of Missed Cleavages] number of potential enzymatic cleavage sites within the identified sequence.
Modifications
The plot will show percentages, i.e. is normalized by the total number of peptide sequences (where different charge state counts as a separate peptide) per Raw file. The sum of frequencies may exceed 100% per Raw file, since a peptide can have multiple modifications.
E.g. given three peptides in a single Raw file1. _M(Oxidation (M))LVLDEADEM(Oxidation (M))LNK_
2. _(Acetyl (Protein N-term))M(Oxidation (M))YGLLLENLSEYIK_
3. DPFIANGER
, the following frequencies arise:
* 33% of 'Acetyl (Protein N-term)'* 33% of 'Oxidation (M)'
* 33% of '2 Oxidation (M)'
* 33% of 'Unmodified'
Thus, 33% of sequences are unmodified, implying 66% are modified at least once. If a modification, e.g. Oxidation(M), occurs multiple times in a single peptide it's listed as a separate modification (e.g. '2 Oxidation (M)' for double oxidation of a single peptide).
FragPipe: Extracting information from the 'Assigned Modifications' column in psm.tsv. [Assigned Modifications] variable modifications (listed by mass in Da) with modified residue and location within the peptide.MS/MS Identified
Peptide Length Distribution
FragPipe: psm.tsv ('Peptide Length': number of residues in the peptide sequence).
MaxQuant: evidence.txt ('Length': the length of the sequence stored in the column 'Sequence').
DIA-NN: report.tsv (the length of the 'Stripped.Sequence').
quantms: *.mzTab (the length of sequence).
Search Engine Scores
Summary of Spectral E-values
Summary of cross-correlation scores
Summary of Search Engine PEP
Consensus Across Search Engines
Quantification Analysis
Peptides Quantification Table
| PeptideID | Protein Name | Peptide Sequence | Best Search Score | Average Intensity | SP=Saccharomyces cerevisiae;CT=Mixture;QY=10%;CV=in-house | SP=Saccharomyces cerevisiae;CT=Mixture;QY=5%;CV=in-house | SP=Saccharomyces cerevisiae;CT=Mixture;QY=3.3%;CV=in-house |
|---|---|---|---|---|---|---|---|
| 1 | sp|P55011|S12A2_HUMAN | AAAAAAAAAAAAAAAGAGAGAK | 0.9999 | 5.1101 | 5.0860 | 5.1404 | 5.0960 |
| 2 | sp|Q99453|PHX2B_HUMAN | AAAAAAAAAK | 1.0000 | 5.9295 | 5.9276 | 5.9481 | 5.9117 |
| 3 | sp|Q96JP5|ZFP91_HUMAN | AAAAAAAAAVSR | 1.0000 | 4.2500 | 4.2237 | 4.2531 | 4.2656 |
| 4 | sp|Q5TF21|SOGA3_HUMAN | AAAAAAAAQMHAK | 1.0000 | 4.9208 | 4.8813 | 4.9496 | 4.9193 |
| 5 | sp|Q9Y4H2|IRS2_HUMAN | AAAAAAAAVPSAGPAGPAPTSAAGR | 1.0000 | 4.6795 | 4.6525 | 4.7113 | 4.6659 |
| 6 | sp|P36578|RL4_HUMAN | AAAAAAALQAK | 1.0000 | 5.6602 | 5.6780 | 5.6812 | 5.6235 |
| 7 | sp|O00178|GTPB1_HUMAN | AAAAAAR | 0.9997 | 4.1917 | 4.0798 | 4.2682 | 4.1818 |
| 8 | sp|Q6SPF0|SAMD1_HUMAN | AAAAAATAPPSPGPAQPGPR | 0.9970 | 4.5783 | 4.5565 | 4.5829 | 4.5895 |
| 9 | sp|O76031|CLPX_HUMAN | AAAAADLANR | 1.0000 | 4.9044 | 4.8651 | 4.9259 | 4.9106 |
| 10 | sp|Q8WUQ7|CATIN_HUMAN | AAAAALSQQQSLQER | 1.0000 | 3.5486 | 3.4986 | 3.5609 | 3.5710 |
| 11 | sp|A6NIH7|U119B_HUMAN | AAAAASAAGPGGLVAGK | 1.0000 | 4.5009 | 4.4867 | 4.5216 | 4.4900 |
| 12 | sp|Q9BTD8|RBM42_HUMAN | AAAAATVVPPMVGGPPFVGPVGFGPGDR | 0.9997 | 4.1653 | 4.1245 | 4.1983 | 4.1603 |
| 13 | sp|Q9P258|RCC2_HUMAN | AAAAAWEEPSSGNGTAR | 1.0000 | 4.8387 | 4.8197 | 4.8616 | 4.8291 |
| 14 | sp|Q99615|DNJC7_HUMAN | AAAAECDVVMAATEPELLDDQEAK | 0.9989 | 4.3740 | 4.3483 | 4.3851 | 4.3813 |
| 15 | sp|Q9Y2U8|MAN1_HUMAN | AAAAGSLDR | 0.9999 | 4.9444 | 4.9107 | 4.9686 | 4.9437 |
| 16 | sp|P0C0T4|RS25B_YEAST;sp|Q3E792|RS25A_YEAST | AAAALAGGK | 0.9999 | 5.8076 | 6.0928 | 5.7184 | 5.4974 |
| 17 | sp|Q15596|NCOA2_HUMAN | AAAANIDEVQK | 1.0000 | 4.1618 | 4.1756 | 4.1710 | 4.1415 |
| 18 | sp|Q9UPT8|ZC3H4_HUMAN | AAAAPAATTATPPPEGAPPQPGVHNLPVPTLFGTVK | 1.0000 | 4.4684 | 4.4335 | 4.5097 | 4.4498 |
| 19 | sp|Q96L91|EP400_HUMAN | AAAAPFQTSQASASAPR | 0.9997 | 4.2268 | 4.1954 | 4.2729 | 4.2001 |
| 20 | sp|P52701|MSH6_HUMAN | AAAAPGASPSPGGDAAWSEAGPGPR | 1.0000 | 5.3677 | 5.4158 | 5.3708 | 5.3244 |
| 21 | sp|P52701|MSH6_HUMAN | AAAAPGASPSPGGDAAWSEAGPGPRPLAR | 1.0000 | 3.5832 | 3.5465 | 3.6371 | 3.5511 |
| 22 | sp|P55036|PSMD4_HUMAN | AAAASAAEAGIATTGTEDSDDALLK | 1.0000 | 4.9622 | 4.9446 | 4.9947 | 4.9408 |
| 23 | sp|P09938|RIR2_YEAST | AAADALSDLEIK | 0.9997 | 4.8986 | 5.1140 | 4.8541 | 4.6881 |
| 24 | sp|O95159|ZFPL1_HUMAN | AAADSDPNLDPLMNPHIR | 1.0000 | 5.1045 | 5.0664 | 5.1372 | 5.0980 |
| 25 | sp|Q6P2E9|EDC4_HUMAN | AAADTLQGPMQAAYR | 1.0000 | 3.6096 | 3.5992 | 3.6228 | 3.6039 |
| 26 | sp|Q6P2E9|EDC4_HUMAN | AAADTLQGPMQAAYR | 1.0000 | 3.3063 | 3.2023 | 3.3229 | 3.3557 |
| 27 | sp|Q9NQP4|PFD4_HUMAN | AAAEDVNVTFEDQQK | 1.0000 | 4.0292 | 3.9906 | 4.0576 | 4.0276 |
| 28 | sp|O95551|TYDP2_HUMAN | AAAEEGHIIPR | 1.0000 | 5.4478 | 5.3897 | 5.4833 | 5.4515 |
| 29 | sp|O15357|SHIP2_HUMAN | AAAEELLAR | 1.0000 | 5.0724 | 5.0563 | 5.0820 | 5.0745 |
| 30 | sp|Q9H9Y2|RPF1_HUMAN | AAAEELQEAAGAGDGATENGVQPPK | 1.0000 | 4.5297 | 4.4950 | 4.5624 | 4.5206 |
| 31 | sp|Q96P70|IPO9_HUMAN | AAAEEQIK | 0.9999 | 5.2276 | 5.1954 | 5.2506 | 5.2273 |
| 32 | sp|P30260|CDC27_HUMAN | AAAEGLMSLLR | 1.0000 | 4.3024 | 4.2771 | 4.3361 | 4.2854 |
| 33 | sp|P00360|G3P1_YEAST | AAAEGPMK | 0.9988 | 3.9138 | 4.1444 | 3.8283 | 3.7290 |
| 34 | sp|P00360|G3P1_YEAST | AAAEGPMK | 1.0000 | 4.7633 | 5.0495 | 4.6743 | 4.4495 |
| 35 | sp|P15180|SYKC_YEAST | AAAEGVANLHLDEATGEMVSK | 1.0000 | 4.2037 | 4.4023 | 4.1753 | 4.0020 |
| 36 | sp|P15180|SYKC_YEAST | AAAEGVANLHLDEATGEMVSK | 1.0000 | 5.0252 | 5.2850 | 4.9685 | 4.7316 |
| 37 | sp|Q9NP50|SHCAF_HUMAN | AAAEKPEEQGPEPLPISTQEW | 1.0000 | 4.6442 | 4.6190 | 4.6637 | 4.6425 |
| 38 | sp|Q01780|EXOSX_HUMAN | AAAEQAISVR | 1.0000 | 4.9211 | 4.9080 | 4.9425 | 4.9085 |
| 39 | sp|O94766|B3GA3_HUMAN | AAAEQLR | 0.9998 | 4.8666 | 4.8356 | 4.8987 | 4.8555 |
| 40 | sp|Q02880|TOP2B_HUMAN | AAAERPK | 0.9991 | 5.2989 | 5.2501 | 5.3288 | 5.3027 |
| 41 | sp|P02786|TFR1_HUMAN | AAAEVAGQFVIK | 0.9999 | 5.7815 | 5.7528 | 5.8144 | 5.7681 |
| 42 | sp|P07954|FUMH_HUMAN | AAAEVNQDYGLDPK | 1.0000 | 5.1767 | 5.1675 | 5.1999 | 5.1594 |
| 43 | sp|P15705|STI1_YEAST | AAAEYEK | 1.0000 | 4.8083 | 5.0531 | 4.7440 | 4.5642 |
| 44 | sp|Q9Y490|TLN1_HUMAN | AAAFEEQENETVVVK | 1.0000 | 5.1944 | 5.1751 | 5.2089 | 5.1939 |
| 45 | sp|Q9P2E9|RRBP1_HUMAN | AAAFEK | 0.9998 | 5.5448 | 5.5160 | 5.5730 | 5.5365 |
| 46 | sp|O94826|TOM70_HUMAN | AAAFEQLQK | 1.0000 | 5.0643 | 5.0542 | 5.0947 | 5.0397 |
| 47 | sp|Q9H9Y2|RPF1_HUMAN | AAAFPPGFSISEIK | 1.0000 | 4.4674 | 4.4606 | 4.4868 | 4.4522 |
| 48 | sp|Q9Y6X3|SCC4_HUMAN | AAAFYVR | 0.9997 | 4.4727 | 4.4467 | 4.4918 | 4.4721 |
| 49 | sp|Q9P2E9|RRBP1_HUMAN | AAAGEAK | 1.0000 | 4.3334 | 4.2981 | 4.3611 | 4.3302 |
| 50 | sp|P23381|SYWC_HUMAN | AAAGEDYK | 1.0000 | 5.1423 | 5.1080 | 5.1395 | 5.1689 |
Protein Quantification Table
| ProteinID | Protein Name | Number of Peptides | Average Intensity | SP=Saccharomyces cerevisiae;CT=Mixture;QY=10%;CV=in-house | SP=Saccharomyces cerevisiae;CT=Mixture;QY=5%;CV=in-house | SP=Saccharomyces cerevisiae;CT=Mixture;QY=3.3%;CV=in-house |
|---|---|---|---|---|---|---|
| 1 | sp|A0A096LP55|QCR6L_HUMAN;sp|P07919|QCR6_HUMAN | 1 | 3.7629 | 3.7228 | 3.7953 | 3.7581 |
| 2 | sp|A0A0B4J2D5|GAL3B_HUMAN;sp|P0DPI2|GAL3A_HUMAN | 9 | 6.5573 | 6.5406 | 6.5786 | 6.5475 |
| 3 | sp|A0A0B4J2F0|PIOS1_HUMAN | 1 | 4.2780 | 4.2463 | 4.3042 | 4.2739 |
| 4 | sp|A0AVF1|IFT56_HUMAN | 3 | 4.4387 | 4.4337 | 4.4436 | 4.4376 |
| 5 | sp|A0AVT1|UBA6_HUMAN | 31 | 6.7475 | 6.7247 | 6.7693 | 6.7418 |
| 6 | sp|A0FGR8|ESYT2_HUMAN | 15 | 6.2588 | 6.2497 | 6.2776 | 6.2462 |
| 7 | sp|A0JNW5|UH1BL_HUMAN | 5 | 5.2052 | 5.1740 | 5.2309 | 5.2013 |
| 8 | sp|A0MZ66|SHOT1_HUMAN | 27 | 6.3095 | 6.2787 | 6.3350 | 6.3057 |
| 9 | sp|A0PJW6|TM223_HUMAN | 3 | 5.4129 | 5.3812 | 5.4432 | 5.4043 |
| 10 | sp|A0PK00|T120B_HUMAN | 1 | 4.7299 | 4.7075 | 4.7537 | 4.7216 |
| 11 | sp|A1A4S6|RHG10_HUMAN | 6 | 5.5921 | 5.5618 | 5.6207 | 5.5843 |
| 12 | sp|A1IGU5|ARH37_HUMAN | 1 | 4.5503 | 4.5026 | 4.5592 | 4.5746 |
| 13 | sp|A1L020|MEX3A_HUMAN | 9 | 6.0197 | 5.9861 | 6.0425 | 6.0206 |
| 14 | sp|A1L0T0|HACL2_HUMAN | 14 | 6.1952 | 6.1741 | 6.2165 | 6.1891 |
| 15 | sp|A1L157|TSN11_HUMAN | 1 | 4.4176 | 4.3933 | 4.4480 | 4.4036 |
| 16 | sp|A1L170|CA226_HUMAN | 1 | 4.3816 | 4.3458 | 4.3944 | 4.3942 |
| 17 | sp|A1L390|PKHG3_HUMAN | 5 | 5.0416 | 4.9997 | 5.0701 | 5.0423 |
| 18 | sp|A1X283|SPD2B_HUMAN | 36 | 6.7276 | 6.7006 | 6.7492 | 6.7250 |
| 19 | sp|A1XBS5|FA92A_HUMAN | 1 | 3.8100 | 3.7434 | 3.8548 | 3.8091 |
| 20 | sp|A2AJT9|BCLA3_HUMAN | 3 | 5.1031 | 5.0738 | 5.1206 | 5.1064 |
| 21 | sp|A2RRD8|ZN320_HUMAN | 1 | 4.3234 | 4.2796 | 4.3412 | 4.3363 |
| 22 | sp|A2RRP1|NBAS_HUMAN | 30 | 6.4328 | 6.3973 | 6.4582 | 6.4323 |
| 23 | sp|A2RTX5|SYTC2_HUMAN | 1 | 4.1704 | 4.1527 | 4.1942 | 4.1588 |
| 24 | sp|A2RU67|F234B_HUMAN | 2 | 4.7223 | 4.7009 | 4.7357 | 4.7243 |
| 25 | sp|A2RUC4|TYW5_HUMAN | 4 | 5.0917 | 5.0634 | 5.1187 | 5.0844 |
| 26 | sp|A3KMH1|VWA8_HUMAN | 33 | 6.4954 | 6.5007 | 6.5080 | 6.4784 |
| 27 | sp|A3KN83|SBNO1_HUMAN | 18 | 6.1917 | 6.1675 | 6.2129 | 6.1877 |
| 28 | sp|A4D161|F221A_HUMAN | 5 | 5.2597 | 5.2262 | 5.2892 | 5.2533 |
| 29 | sp|A4D1E9|GTPBA_HUMAN | 5 | 5.6777 | 5.6564 | 5.6990 | 5.6714 |
| 30 | sp|A4D1P6|WDR91_HUMAN | 13 | 5.9108 | 5.8814 | 5.9328 | 5.9095 |
| 31 | sp|A4D1U4|DEN11_HUMAN | 3 | 4.5285 | 4.4789 | 4.5649 | 4.5257 |
| 32 | sp|A4D2B0|MBLC1_HUMAN | 2 | 4.1057 | 4.0507 | 4.1030 | 4.1454 |
| 33 | sp|A5D8V6|VP37C_HUMAN | 3 | 5.1016 | 5.0754 | 5.1207 | 5.1012 |
| 34 | sp|A5PLL7|PDES1_HUMAN | 2 | 5.1872 | 5.1639 | 5.2028 | 5.1883 |
| 35 | sp|A5PLN9|TPC13_HUMAN | 3 | 5.6313 | 5.5989 | 5.6598 | 5.6251 |
| 36 | sp|A5YKK6|CNOT1_HUMAN | 53 | 6.9213 | 6.8919 | 6.9446 | 6.9186 |
| 37 | sp|A6H8Y1|BDP1_HUMAN | 2 | 4.9599 | 4.9276 | 4.9915 | 4.9504 |
| 38 | sp|A6NC57|ANR62_HUMAN | 1 | 3.3462 | 3.2325 | 3.3558 | 3.4070 |
| 39 | sp|A6NCE7|MP3B2_HUMAN;sp|Q9GZQ8|MLP3B_HUMAN | 2 | 5.3332 | 5.3261 | 5.3676 | 5.3015 |
| 40 | sp|A6NCS6|CB072_HUMAN | 4 | 4.7068 | 4.6902 | 4.7139 | 4.7118 |
| 41 | sp|A6ND36|FA83G_HUMAN | 3 | 4.9101 | 4.9036 | 4.9309 | 4.8935 |
| 42 | sp|A6NDB9|PALM3_HUMAN | 11 | 5.7112 | 5.6822 | 5.7320 | 5.7110 |
| 43 | sp|A6NDE4|RBY1B_HUMAN;sp|A6NEQ0|RBY1E_HUMAN;sp|P0C7P1|RBY1D_HUMAN;sp|P0DJD3|RBY1A_HUMAN;sp|P0DJD4|RBY1C_HUMAN;sp|Q15415|RBY1F_HUMAN | 1 | 4.7747 | 4.7245 | 4.7941 | 4.7901 |
| 44 | sp|A6NDG6|PGP_HUMAN | 5 | 5.8649 | 5.8390 | 5.8840 | 5.8643 |
| 45 | sp|A6NDU8|CE051_HUMAN | 2 | 4.8114 | 4.7871 | 4.8268 | 4.8133 |
| 46 | sp|A6NDX5|ZN840_HUMAN | 1 | 4.3298 | 4.2876 | 4.3691 | 4.3187 |
| 47 | sp|A6NED2|RCCD1_HUMAN | 3 | 4.7508 | 4.7096 | 4.7662 | 4.7645 |
| 48 | sp|A6NFI3|ZN316_HUMAN | 2 | 4.9098 | 4.8857 | 4.9296 | 4.9071 |
| 49 | sp|A6NGN9|IGLO5_HUMAN | 2 | 5.0687 | 5.0540 | 5.0837 | 5.0642 |
| 50 | sp|A6NHL2|TBAL3_HUMAN | 1 | 4.0439 | 3.9831 | 4.0709 | 4.0582 |
Peptide Intensity Distribution
FragPipe: Use the 'Intensity' column from psm.tsv and apply a log2 transformation.
Flat image plot. Toolbox functions such as highlighting / hiding samples will not work (see the docs).
MS1 Analysis
Total Ion Chromatograms
MS1 Base Peak Chromatograms
MS1 Peaks
General stats for MS1 information
| Sample Name | Acquisition Date Time | log10(Total Current) | log10(Scan Current) |
|---|---|---|---|
| Sample 1 | - | 14.3842 | 11.8517 |
2017-04-05 00:38:45 | 13.3186 | 10.7826 | |
2017-04-05 04:14:11 | 13.1799 | 10.6932 | |
2017-04-05 07:49:24 | 13.3878 | 10.7992 | |
2017-04-05 11:24:37 | 13.4434 | 10.8149 | |
2017-04-05 15:00:06 | 13.3927 | 10.8790 | |
2017-04-05 18:32:46 | 13.3876 | 10.9186 | |
2017-04-05 22:05:41 | 13.4376 | 10.9428 | |
2017-04-06 10:43:06 | 13.3235 | 10.8011 | |
2017-04-06 14:15:46 | 13.4091 | 10.8419 | |
2017-04-06 17:48:21 | 13.4054 | 10.8081 | |
2017-04-06 21:21:20 | 12.7353 | 10.4647 | |
| Sample 2 | - | 14.3842 | 11.8517 |
2017-04-05 00:38:45 | 13.3186 | 10.7826 | |
2017-04-05 04:14:11 | 13.1799 | 10.6932 | |
2017-04-05 07:49:24 | 13.3878 | 10.7992 | |
2017-04-05 11:24:37 | 13.4434 | 10.8149 | |
2017-04-05 15:00:06 | 13.3927 | 10.8790 | |
2017-04-05 18:32:46 | 13.3876 | 10.9186 | |
2017-04-05 22:05:41 | 13.4376 | 10.9428 | |
2017-04-06 10:43:06 | 13.3235 | 10.8011 | |
2017-04-06 14:15:46 | 13.4091 | 10.8419 | |
2017-04-06 17:48:21 | 13.4054 | 10.8081 | |
2017-04-06 21:21:20 | 12.7353 | 10.4647 | |
| Sample 3 | - | 14.3842 | 11.8517 |
2017-04-05 00:38:45 | 13.3186 | 10.7826 | |
2017-04-05 04:14:11 | 13.1799 | 10.6932 | |
2017-04-05 07:49:24 | 13.3878 | 10.7992 | |
2017-04-05 11:24:37 | 13.4434 | 10.8149 | |
2017-04-05 15:00:06 | 13.3927 | 10.8790 | |
2017-04-05 18:32:46 | 13.3876 | 10.9186 | |
2017-04-05 22:05:41 | 13.4376 | 10.9428 | |
2017-04-06 10:43:06 | 13.3235 | 10.8011 | |
2017-04-06 14:15:46 | 13.4091 | 10.8419 | |
2017-04-06 17:48:21 | 13.4054 | 10.8081 | |
2017-04-06 21:21:20 | 12.7353 | 10.4647 | |
| Sample 4 | - | 14.3842 | 11.8517 |
2017-04-05 00:38:45 | 13.3186 | 10.7826 | |
2017-04-05 04:14:11 | 13.1799 | 10.6932 | |
2017-04-05 07:49:24 | 13.3878 | 10.7992 | |
2017-04-05 11:24:37 | 13.4434 | 10.8149 | |
2017-04-05 15:00:06 | 13.3927 | 10.8790 | |
2017-04-05 18:32:46 | 13.3876 | 10.9186 | |
2017-04-05 22:05:41 | 13.4376 | 10.9428 | |
2017-04-06 10:43:06 | 13.3235 | 10.8011 | |
2017-04-06 14:15:46 | 13.4091 | 10.8419 | |
2017-04-06 17:48:21 | 13.4054 | 10.8081 | |
2017-04-06 21:21:20 | 12.7353 | 10.4647 | |
| Sample 5 | - | 14.3842 | 11.8517 |
2017-04-05 00:38:45 | 13.3186 | 10.7826 | |
2017-04-05 04:14:11 | 13.1799 | 10.6932 | |
2017-04-05 07:49:24 | 13.3878 | 10.7992 | |
2017-04-05 11:24:37 | 13.4434 | 10.8149 | |
2017-04-05 15:00:06 | 13.3927 | 10.8790 | |
2017-04-05 18:32:46 | 13.3876 | 10.9186 | |
2017-04-05 22:05:41 | 13.4376 | 10.9428 | |
2017-04-06 10:43:06 | 13.3235 | 10.8011 | |
2017-04-06 14:15:46 | 13.4091 | 10.8419 | |
2017-04-06 17:48:21 | 13.4054 | 10.8081 | |
2017-04-06 21:21:20 | 12.7353 | 10.4647 | |
| Sample 6 | - | 14.3842 | 11.8517 |
2017-04-05 00:38:45 | 13.3186 | 10.7826 | |
2017-04-05 04:14:11 | 13.1799 | 10.6932 | |
2017-04-05 07:49:24 | 13.3878 | 10.7992 | |
2017-04-05 11:24:37 | 13.4434 | 10.8149 | |
2017-04-05 15:00:06 | 13.3927 | 10.8790 | |
2017-04-05 18:32:46 | 13.3876 | 10.9186 | |
2017-04-05 22:05:41 | 13.4376 | 10.9428 | |
2017-04-06 10:43:06 | 13.3235 | 10.8011 | |
2017-04-06 14:15:46 | 13.4091 | 10.8419 | |
2017-04-06 17:48:21 | 13.4054 | 10.8081 | |
2017-04-06 21:21:20 | 12.7353 | 10.4647 | |
| Sample 7 | - | 14.3842 | 11.8517 |
2017-04-05 00:38:45 | 13.3186 | 10.7826 | |
2017-04-05 04:14:11 | 13.1799 | 10.6932 | |
2017-04-05 07:49:24 | 13.3878 | 10.7992 | |
2017-04-05 11:24:37 | 13.4434 | 10.8149 | |
2017-04-05 15:00:06 | 13.3927 | 10.8790 | |
2017-04-05 18:32:46 | 13.3876 | 10.9186 | |
2017-04-05 22:05:41 | 13.4376 | 10.9428 | |
2017-04-06 10:43:06 | 13.3235 | 10.8011 | |
2017-04-06 14:15:46 | 13.4091 | 10.8419 | |
2017-04-06 17:48:21 | 13.4054 | 10.8081 | |
2017-04-06 21:21:20 | 12.7353 | 10.4647 | |
| Sample 8 | - | 14.3842 | 11.8517 |
2017-04-05 00:38:45 | 13.3186 | 10.7826 | |
2017-04-05 04:14:11 | 13.1799 | 10.6932 | |
2017-04-05 07:49:24 | 13.3878 | 10.7992 | |
2017-04-05 11:24:37 | 13.4434 | 10.8149 | |
2017-04-05 15:00:06 | 13.3927 | 10.8790 | |
2017-04-05 18:32:46 | 13.3876 | 10.9186 | |
2017-04-05 22:05:41 | 13.4376 | 10.9428 | |
2017-04-06 10:43:06 | 13.3235 | 10.8011 | |
2017-04-06 14:15:46 | 13.4091 | 10.8419 | |
2017-04-06 17:48:21 | 13.4054 | 10.8081 | |
2017-04-06 21:21:20 | 12.7353 | 10.4647 | |
| Sample 9 | - | 14.3842 | 11.8517 |
2017-04-05 00:38:45 | 13.3186 | 10.7826 | |
2017-04-05 04:14:11 | 13.1799 | 10.6932 | |
2017-04-05 07:49:24 | 13.3878 | 10.7992 | |
2017-04-05 11:24:37 | 13.4434 | 10.8149 | |
2017-04-05 15:00:06 | 13.3927 | 10.8790 | |
2017-04-05 18:32:46 | 13.3876 | 10.9186 | |
2017-04-05 22:05:41 | 13.4376 | 10.9428 | |
2017-04-06 10:43:06 | 13.3235 | 10.8011 | |
2017-04-06 14:15:46 | 13.4091 | 10.8419 | |
2017-04-06 17:48:21 | 13.4054 | 10.8081 | |
2017-04-06 21:21:20 | 12.7353 | 10.4647 | |
| Sample 10 | - | 14.3842 | 11.8517 |
2017-04-05 00:38:45 | 13.3186 | 10.7826 | |
2017-04-05 04:14:11 | 13.1799 | 10.6932 | |
2017-04-05 07:49:24 | 13.3878 | 10.7992 | |
2017-04-05 11:24:37 | 13.4434 | 10.8149 | |
2017-04-05 15:00:06 | 13.3927 | 10.8790 | |
2017-04-05 18:32:46 | 13.3876 | 10.9186 | |
2017-04-05 22:05:41 | 13.4376 | 10.9428 | |
2017-04-06 10:43:06 | 13.3235 | 10.8011 | |
2017-04-06 14:15:46 | 13.4091 | 10.8419 | |
2017-04-06 17:48:21 | 13.4054 | 10.8081 | |
2017-04-06 21:21:20 | 12.7353 | 10.4647 | |
| Sample 11 | - | 14.3842 | 11.8517 |
2017-04-05 00:38:45 | 13.3186 | 10.7826 | |
2017-04-05 04:14:11 | 13.1799 | 10.6932 | |
2017-04-05 07:49:24 | 13.3878 | 10.7992 | |
2017-04-05 11:24:37 | 13.4434 | 10.8149 | |
2017-04-05 15:00:06 | 13.3927 | 10.8790 | |
2017-04-05 18:32:46 | 13.3876 | 10.9186 | |
2017-04-05 22:05:41 | 13.4376 | 10.9428 | |
2017-04-06 10:43:06 | 13.3235 | 10.8011 | |
2017-04-06 14:15:46 | 13.4091 | 10.8419 | |
2017-04-06 17:48:21 | 13.4054 | 10.8081 | |
2017-04-06 21:21:20 | 12.7353 | 10.4647 |
MS1 TIC Proxy
MS2 and Spectral Stats
Number of Peaks per MS/MS spectrum
Peak Intensity Distribution
Pipeline Spectrum Tracking
| Sample Name | #MS1 Spectra | #MS2 Spectra | MSGF | Comet | #PSMs from quant. peptides | #Peptides quantified |
|---|---|---|---|---|---|---|
| Sample 1 | 69327 | 433836 | 280606 | 277765 | 154772 | 90555 |
6870 | 37330 | 24401 | 24117 | 13935 | 11763 | |
6471 | 37536 | 24920 | 24702 | 14683 | 13183 | |
7266 | 38047 | 24711 | 24518 | 14027 | 12475 | |
7649 | 37733 | 24986 | 24790 | 14661 | 12995 | |
5657 | 41445 | 26957 | 26729 | 15121 | 13672 | |
5982 | 42856 | 29469 | 29222 | 18909 | 17336 | |
7075 | 40809 | 27720 | 27427 | 17667 | 15735 | |
5947 | 40698 | 26495 | 26127 | 15303 | 13323 | |
6051 | 41078 | 26992 | 26761 | 15630 | 13808 | |
6062 | 39997 | 26228 | 25738 | 14819 | 13170 | |
4297 | 36307 | 17727 | 17634 | 17 | 12 | |
| Sample 2 | 69327 | 433836 | 280606 | 277765 | 154772 | 90555 |
6870 | 37330 | 24401 | 24117 | 13935 | 11763 | |
6471 | 37536 | 24920 | 24702 | 14683 | 13183 | |
7266 | 38047 | 24711 | 24518 | 14027 | 12475 | |
7649 | 37733 | 24986 | 24790 | 14661 | 12995 | |
5657 | 41445 | 26957 | 26729 | 15121 | 13672 | |
5982 | 42856 | 29469 | 29222 | 18909 | 17336 | |
7075 | 40809 | 27720 | 27427 | 17667 | 15735 | |
5947 | 40698 | 26495 | 26127 | 15303 | 13323 | |
6051 | 41078 | 26992 | 26761 | 15630 | 13808 | |
6062 | 39997 | 26228 | 25738 | 14819 | 13170 | |
4297 | 36307 | 17727 | 17634 | 17 | 12 | |
| Sample 3 | 69327 | 433836 | 280606 | 277765 | 154772 | 90555 |
6870 | 37330 | 24401 | 24117 | 13935 | 11763 | |
6471 | 37536 | 24920 | 24702 | 14683 | 13183 | |
7266 | 38047 | 24711 | 24518 | 14027 | 12475 | |
7649 | 37733 | 24986 | 24790 | 14661 | 12995 | |
5657 | 41445 | 26957 | 26729 | 15121 | 13672 | |
5982 | 42856 | 29469 | 29222 | 18909 | 17336 | |
7075 | 40809 | 27720 | 27427 | 17667 | 15735 | |
5947 | 40698 | 26495 | 26127 | 15303 | 13323 | |
6051 | 41078 | 26992 | 26761 | 15630 | 13808 | |
6062 | 39997 | 26228 | 25738 | 14819 | 13170 | |
4297 | 36307 | 17727 | 17634 | 17 | 12 | |
| Sample 4 | 69327 | 433836 | 280606 | 277765 | 154772 | 90555 |
6870 | 37330 | 24401 | 24117 | 13935 | 11763 | |
6471 | 37536 | 24920 | 24702 | 14683 | 13183 | |
7266 | 38047 | 24711 | 24518 | 14027 | 12475 | |
7649 | 37733 | 24986 | 24790 | 14661 | 12995 | |
5657 | 41445 | 26957 | 26729 | 15121 | 13672 | |
5982 | 42856 | 29469 | 29222 | 18909 | 17336 | |
7075 | 40809 | 27720 | 27427 | 17667 | 15735 | |
5947 | 40698 | 26495 | 26127 | 15303 | 13323 | |
6051 | 41078 | 26992 | 26761 | 15630 | 13808 | |
6062 | 39997 | 26228 | 25738 | 14819 | 13170 | |
4297 | 36307 | 17727 | 17634 | 17 | 12 | |
| Sample 5 | 69327 | 433836 | 280606 | 277765 | 154772 | 90555 |
6870 | 37330 | 24401 | 24117 | 13935 | 11763 | |
6471 | 37536 | 24920 | 24702 | 14683 | 13183 | |
7266 | 38047 | 24711 | 24518 | 14027 | 12475 | |
7649 | 37733 | 24986 | 24790 | 14661 | 12995 | |
5657 | 41445 | 26957 | 26729 | 15121 | 13672 | |
5982 | 42856 | 29469 | 29222 | 18909 | 17336 | |
7075 | 40809 | 27720 | 27427 | 17667 | 15735 | |
5947 | 40698 | 26495 | 26127 | 15303 | 13323 | |
6051 | 41078 | 26992 | 26761 | 15630 | 13808 | |
6062 | 39997 | 26228 | 25738 | 14819 | 13170 | |
4297 | 36307 | 17727 | 17634 | 17 | 12 | |
| Sample 6 | 69327 | 433836 | 280606 | 277765 | 154772 | 90555 |
6870 | 37330 | 24401 | 24117 | 13935 | 11763 | |
6471 | 37536 | 24920 | 24702 | 14683 | 13183 | |
7266 | 38047 | 24711 | 24518 | 14027 | 12475 | |
7649 | 37733 | 24986 | 24790 | 14661 | 12995 | |
5657 | 41445 | 26957 | 26729 | 15121 | 13672 | |
5982 | 42856 | 29469 | 29222 | 18909 | 17336 | |
7075 | 40809 | 27720 | 27427 | 17667 | 15735 | |
5947 | 40698 | 26495 | 26127 | 15303 | 13323 | |
6051 | 41078 | 26992 | 26761 | 15630 | 13808 | |
6062 | 39997 | 26228 | 25738 | 14819 | 13170 | |
4297 | 36307 | 17727 | 17634 | 17 | 12 | |
| Sample 7 | 69327 | 433836 | 280606 | 277765 | 154772 | 90555 |
6870 | 37330 | 24401 | 24117 | 13935 | 11763 | |
6471 | 37536 | 24920 | 24702 | 14683 | 13183 | |
7266 | 38047 | 24711 | 24518 | 14027 | 12475 | |
7649 | 37733 | 24986 | 24790 | 14661 | 12995 | |
5657 | 41445 | 26957 | 26729 | 15121 | 13672 | |
5982 | 42856 | 29469 | 29222 | 18909 | 17336 | |
7075 | 40809 | 27720 | 27427 | 17667 | 15735 | |
5947 | 40698 | 26495 | 26127 | 15303 | 13323 | |
6051 | 41078 | 26992 | 26761 | 15630 | 13808 | |
6062 | 39997 | 26228 | 25738 | 14819 | 13170 | |
4297 | 36307 | 17727 | 17634 | 17 | 12 | |
| Sample 8 | 69327 | 433836 | 280606 | 277765 | 154772 | 90555 |
6870 | 37330 | 24401 | 24117 | 13935 | 11763 | |
6471 | 37536 | 24920 | 24702 | 14683 | 13183 | |
7266 | 38047 | 24711 | 24518 | 14027 | 12475 | |
7649 | 37733 | 24986 | 24790 | 14661 | 12995 | |
5657 | 41445 | 26957 | 26729 | 15121 | 13672 | |
5982 | 42856 | 29469 | 29222 | 18909 | 17336 | |
7075 | 40809 | 27720 | 27427 | 17667 | 15735 | |
5947 | 40698 | 26495 | 26127 | 15303 | 13323 | |
6051 | 41078 | 26992 | 26761 | 15630 | 13808 | |
6062 | 39997 | 26228 | 25738 | 14819 | 13170 | |
4297 | 36307 | 17727 | 17634 | 17 | 12 | |
| Sample 9 | 69327 | 433836 | 280606 | 277765 | 154772 | 90555 |
6870 | 37330 | 24401 | 24117 | 13935 | 11763 | |
6471 | 37536 | 24920 | 24702 | 14683 | 13183 | |
7266 | 38047 | 24711 | 24518 | 14027 | 12475 | |
7649 | 37733 | 24986 | 24790 | 14661 | 12995 | |
5657 | 41445 | 26957 | 26729 | 15121 | 13672 | |
5982 | 42856 | 29469 | 29222 | 18909 | 17336 | |
7075 | 40809 | 27720 | 27427 | 17667 | 15735 | |
5947 | 40698 | 26495 | 26127 | 15303 | 13323 | |
6051 | 41078 | 26992 | 26761 | 15630 | 13808 | |
6062 | 39997 | 26228 | 25738 | 14819 | 13170 | |
4297 | 36307 | 17727 | 17634 | 17 | 12 | |
| Sample 10 | 69327 | 433836 | 280606 | 277765 | 154772 | 90555 |
6870 | 37330 | 24401 | 24117 | 13935 | 11763 | |
6471 | 37536 | 24920 | 24702 | 14683 | 13183 | |
7266 | 38047 | 24711 | 24518 | 14027 | 12475 | |
7649 | 37733 | 24986 | 24790 | 14661 | 12995 | |
5657 | 41445 | 26957 | 26729 | 15121 | 13672 | |
5982 | 42856 | 29469 | 29222 | 18909 | 17336 | |
7075 | 40809 | 27720 | 27427 | 17667 | 15735 | |
5947 | 40698 | 26495 | 26127 | 15303 | 13323 | |
6051 | 41078 | 26992 | 26761 | 15630 | 13808 | |
6062 | 39997 | 26228 | 25738 | 14819 | 13170 | |
4297 | 36307 | 17727 | 17634 | 17 | 12 | |
| Sample 11 | 69327 | 433836 | 280606 | 277765 | 154772 | 90555 |
6870 | 37330 | 24401 | 24117 | 13935 | 11763 | |
6471 | 37536 | 24920 | 24702 | 14683 | 13183 | |
7266 | 38047 | 24711 | 24518 | 14027 | 12475 | |
7649 | 37733 | 24986 | 24790 | 14661 | 12995 | |
5657 | 41445 | 26957 | 26729 | 15121 | 13672 | |
5982 | 42856 | 29469 | 29222 | 18909 | 17336 | |
7075 | 40809 | 27720 | 27427 | 17667 | 15735 | |
5947 | 40698 | 26495 | 26127 | 15303 | 13323 | |
6051 | 41078 | 26992 | 26761 | 15630 | 13808 | |
6062 | 39997 | 26228 | 25738 | 14819 | 13170 | |
4297 | 36307 | 17727 | 17634 | 17 | 12 |
Distribution of Precursor Charges
Charge-state
Precursor ion charge states are based on mzTab data.
MS/MS Counts Per 3D-peak
MS2 Precursor Intensity Trend
Mass Error Trends
Delta Mass [Da]
Delta Mass [ppm]
RT Quality Control
IDs over RT
This plot allows to judge column occupancy over retention time. Ideally, the LC gradient is chosen such that the number of identifications (here, after FDR filtering) is uniform over time, to ensure consistent instrument duty cycles. Sharp peaks and uneven distribution of identifications over time indicate potential for LC gradient optimization. See [Moruz 2014, DOI: 10.1002/pmic.201400036](https://pubmed.ncbi.nlm.nih.gov/24700534/) for details.
MS1 Retention Time Trend
Software Versions
Software Versions lists versions of software tools extracted from file contents.
| Group | Software | Version |
|---|---|---|
| CONSENSUSID | ConsensusID | 3.3.0-pre-exported-20250122 |
| DECOYDATABASE | DecoyDatabase | 3.3.0-pre-exported-20250122 |
| FDRCONSENSUSID | FalseDiscoveryRate | 3.3.0-pre-exported-20250122 |
| IDFILTER | IDFilter | 3.3.0-pre-exported-20250122 |
| MS2RESCORE | MS2Rescore | 3.1.4 |
| deeplc | 3.1.8 | |
| ms2pip | 4.1.0 | |
| quantms-rescoring | 0.0.5 | |
| MSGFDBINDEXING | msgf_plus | MS-GF+ Release (v2024.03.26) (26 March 2024) |
| MZMLSTATISTICS | quantms-utils | 0.0.20 |
| PERCOLATOR | PercolatorAdapter | 3.3.0-pre-exported-20250122 |
| percolator | 3.05.0, Build Date Aug 31 2020 19:03:04 | |
| PROTEOMICSLFQ | ProteomicsLFQ | 3.3.0-pre-exported-20250122 |
| SAMPLESHEET_CHECK | quantms-utils | 0.0.20 |
| SDRFPARSING | sdrf-pipelines | 0.0.31 |
| SEARCHENGINECOMET | Comet | 2023.01 rev. 2 |
| CometAdapter | 3.3.0-pre-exported-20250122 | |
| SEARCHENGINEMSGF | MSGFPlusAdapter | 3.3.0-pre-exported-20250122 |
| msgf_plus | MS-GF+ Release (v2023.01.12) (12 January 2023) | |
| THERMORAWFILEPARSER | ThermoRawFileParser | 1.3.4 |
| Workflow | Nextflow | 24.10.5 |
| bigbio/quantms | v1.4.0dev |
bigbio/quantms Workflow Summary
- this information is collected when the pipeline is started.https://github.com/bigbio/quantms
Input/output options
- export_decoy_psm
- true
- input
- /mnt/daicx/pvc-afbfaa68-aa52-416c-b273-64fb016fd745/mcp/PXD007683/PXD007683-LFQ.sdrf.tsv
- local_input_type
- raw
- outdir
- ./PXD007683_msgf_comet_ms2rescore_quant
- root_folder
- /mnt/daicx/pvc-afbfaa68-aa52-416c-b273-64fb016fd745/mcp/PXD007683
SDRF validation
- skip_factor_validation
- true
- use_ols_cache_only
- true
- validate_ontologies
- true
Protein database
- add_decoys
- true
- database
- /mnt/daicx/pvc-afbfaa68-aa52-416c-b273-64fb016fd745/mcp/PXD007683/uniprot-UP000005640_UP000002311_reviewed.fasta
Database search
- search_engines
- msgf,comet
Modification localization
- luciphor_debug
- 0
PSM re-scoring (general)
- ms2pip_model
- HCD
- ms2pip_model_dir
- /mnt/daicx/pvc-afbfaa68-aa52-416c-b273-64fb016fd745/model_file/
- ms2rescore
- true
- run_fdr_cutoff
- 0.10
PSM re-scoring (Percolator)
- description_correct_features
- 0
Consensus ID
- consensusid_considered_top_hits
- 0
- min_consensus_support
- 0
Isobaric analyzer
- quant_activation_method
- HCD
Protein Quantification (LFQ)
- feature_with_id_min_score
- 0.10
Statistical post-processing
- contrasts
- pairwise
- skip_post_msstats
- true
Quality control
- enable_pmultiqc
- true
- pmultiqc_idxml_skip
- true
Generic options
- trace_report_suffix
- 2025-03-30_11-14-03
Core Nextflow options
- configFiles
- /mnt/daicx/pvc-afbfaa68-aa52-416c-b273-64fb016fd745/mcp/gitrepo/new_quantms/quantms/nextflow.config, /mnt/daicx/pvc-afbfaa68-aa52-416c-b273-64fb016fd745/mcp/k8s_next.config
- containerEngine
- docker
- launchDir
- /mnt/daicx/pvc-afbfaa68-aa52-416c-b273-64fb016fd745/mcp/gitrepo/new_quantms/quantms
- profile
- docker
- projectDir
- /mnt/daicx/pvc-afbfaa68-aa52-416c-b273-64fb016fd745/mcp/gitrepo/new_quantms/quantms
- runName
- mad_hodgkin
- userName
- daicx
- workDir
- /mnt/daicx/pvc-afbfaa68-aa52-416c-b273-64fb016fd745/mcp/gitrepo/new_quantms/quantms/work
bigbio/quantms Methods Description
Suggested text and references to use when describing pipeline usage within the methods section of a publication.https://github.com/bigbio/quantms
Methods
Data was processed using bigbio/quantms v1.4.0dev (doi: 10.5281/zenodo.7754148) of the nf-core collection of workflows (Ewels et al., 2020), utilising reproducible software environments from the Bioconda (Grüning et al., 2018) and Biocontainers (da Veiga Leprevost et al., 2017) projects.
The pipeline was executed with Nextflow v24.10.5 (Di Tommaso et al., 2017) with the following command:
nextflow run main.nf --input /mnt/daicx/pvc-afbfaa68-aa52-416c-b273-64fb016fd745/mcp/PXD007683/PXD007683-LFQ.sdrf.tsv --database /mnt/daicx/pvc-afbfaa68-aa52-416c-b273-64fb016fd745/mcp/PXD007683/uniprot-UP000005640_UP000002311_reviewed.fasta --add_decoys true --search_engines msgf,comet -resume PXD007683 -c /mnt/daicx/pvc-afbfaa68-aa52-416c-b273-64fb016fd745/mcp/k8s_next.config -profile docker --ms2rescore true --ms2pip_model_dir /mnt/daicx/pvc-afbfaa68-aa52-416c-b273-64fb016fd745/model_file/ --root_folder /mnt/daicx/pvc-afbfaa68-aa52-416c-b273-64fb016fd745/mcp/PXD007683 --local_input_type raw --ms2pip_model HCD --outdir ./PXD007683_msgf_comet_ms2rescore_quant --skip_post_msstats true
References
- Di Tommaso, P., Chatzou, M., Floden, E. W., Barja, P. P., Palumbo, E., & Notredame, C. (2017). Nextflow enables reproducible computational workflows. Nature Biotechnology, 35(4), 316-319. doi: 10.1038/nbt.3820
- Ewels, P. A., Peltzer, A., Fillinger, S., Patel, H., Alneberg, J., Wilm, A., Garcia, M. U., Di Tommaso, P., & Nahnsen, S. (2020). The nf-core framework for community-curated bioinformatics pipelines. Nature Biotechnology, 38(3), 276-278. doi: 10.1038/s41587-020-0439-x
- Grüning, B., Dale, R., Sjödin, A., Chapman, B. A., Rowe, J., Tomkins-Tinch, C. H., Valieris, R., Köster, J., & Bioconda Team. (2018). Bioconda: sustainable and comprehensive software distribution for the life sciences. Nature Methods, 15(7), 475–476. doi: 10.1038/s41592-018-0046-7
- da Veiga Leprevost, F., Grüning, B. A., Alves Aflitos, S., Röst, H. L., Uszkoreit, J., Barsnes, H., Vaudel, M., Moreno, P., Gatto, L., Weber, J., Bai, M., Jimenez, R. C., Sachsenberg, T., Pfeuffer, J., Vera Alvarez, R., Griss, J., Nesvizhskii, A. I., & Perez-Riverol, Y. (2017). BioContainers: an open-source and community-driven framework for software standardization. Bioinformatics (Oxford, England), 33(16), 2580–2582. doi: 10.1093/bioinformatics/btx192
Notes:
- The command above does not include parameters contained in any configs or profiles that may have been used. Ensure the config file is also uploaded with your publication!
- You should also cite all software used within this run. Check the "Software Versions" of this report to get version information.